Holisticon Poland logo

Front-end UI/UX Engineer

Holisticon Poland
Department:Product Design
Type:REMOTE
Region:EU
Location:Poland
Experience:Associate
Salary:PLN180,000 - PLN216,000
Skills:
REACTTYPESCRIPTUIUXFIGMASKETCHCSSPLAYWRIGHTTESTINGLIBRARYJESTWCAGHTMLARIADESIGNSYSTEMRESTGRAPHQLPERFORMANCEOPTIMIZATIONDATAVISUALIZATIOND3OPENLAYERSSTORYBOOKANALYTICSTELEMETRY
Share this job:

Job Description

Posted on: March 20, 2026

Holisticon Connect is a division within NEXER GROUP - a custom software development company. We started in Poland in 2017 and are now a team of over 140 people. We have the opportunity to work with world-renowned brands from Scandinavia, the UK, and Western Europe. Our goal is to grow stronger, in competence rather than in numbers. If you like what we do, check out our offer, maybe we will have the pleasure of meeting you! 😊

We are looking for a Senior Frontend Engineer (UI/UX Focus) who will take ownership of designing and building intuitive, high-performance user interfaces for advanced, AI-powered image analysis solutions. In this role, you will work closely with cross-functional teams — including software engineers, product owners, and domain experts — to translate complex scientific and product requirements into elegant, user-centered experiences. You will play a key role in shaping the frontend architecture, driving UX decisions, and evolving a scalable design system, ensuring both usability and technical excellence.

We offer a choice of employment form: B2B or Employment Contract:

  • UoP: 15 000 – 18 000 PLN gross/month
  • B2B: 120 – 150 PLN net/hour + VAT

You might be the perfect match if you are/have:

  • Have at least 5 years of professional experience in frontend development;
  • Have strong expertise in React and TypeScript, including hooks, state management, and modern frontend patterns;
  • Have hands-on experience with UI/UX design practices and tools (e.g. Figma, Sketch), including wireframing, prototyping, and user flows;
  • Have excellent knowledge of CSS, including CSS-in-JS or utility frameworks, responsive design, and cross-browser compatibility;
  • Have experience with automated testing (Playwright for E2E, Testing Library/Jest for unit and integration tests);
  • Understand accessibility standards (WCAG), semantic HTML, and ARIA best practices;
  • Have experience building or evolving a design system and component libraries;
  • Have worked with APIs (REST, GraphQL, or similar), including authentication, caching, and error handling;
  • Understand frontend performance optimization (e.g. code splitting, lazy loading, profiling).

Moreover, we appreciate skills in these areas:

  • Experience with data visualization (e.g. D3, OpenLayers or similar);
  • Familiarity with Storybook-driven development;
  • Basic backend awareness to support effective end-to-end collaboration;
  • Experience with analytics and telemetry (tracking user behavior, product insights).

By joining us, you gain the following:

  • Opportunity to work on exciting, international projects in cutting-edge industries like Automotive, Biotech, IoT;
  • Possibility to develop in cloud technologies;
  • Becoming part of a team that believes that the next step to a promising future is to put your heart into it and make it happen;
  • Respect for your private life so you don't have to work overtime or on weekends;
  • Team Events budget to socialize outside of work;
  • Company Events to celebrate smaller and bigger successes (Summer Party, Programmer's Day, and trips abroad – so far we've been in South Africa, Are, and Barcelona).

Perks and benefits:

  • Fully remote work or in our office in Wrocław;
  • Benefits such as Luxmed, Multisport, and life insurance in Nationale Nederlanden;
  • Attractive referral system (9,5k for senior, 6k for mid, 2,5k for junior);
  • Personal Training Budget with additional paid hours;
  • Passion Day - an extra day off for your hobby to spend as you please;
  • Flexible working hours with no micro-management approach. Our core hours are 9-15, the rest of the working time is up to you;
  • We provide high-quality work equipment + 2 additional monitors and accessories.

If you apply for this position and match our expectations, then:

  • You will be invited for an HR screening to get to know your experience, expectations, and motivation;
  • You will complete a coding test (HackerRank) to demonstrate your technical skills;
  • You will be invited for a technical interview (~60 minutes) to discuss your approach, problem-solving, and frontend expertise in more depth;
  • You will meet the team members to learn more about the project and see how we collaborate on a daily basis.

Submit your application online in one easy step! Apply now!

Originally posted on LinkedIn

Apply now

Please let the company know that you found this position on our job board. This is a great way to support us, so we can keep posting cool jobs every day!

Holisticon Poland logo

Holisticon Poland

View company page
DesignRemoteJobs.com logo

DesignRemoteJobs.com

Get DesignRemoteJobs.com on your phone!