Lensa logo

GIS Developer (REMOTE)

Lensa
Department:Web Design
Type:REMOTE
Region:USA
Location:Santa Ana, CA
Experience:Mid-Senior level
Estimated Salary:$90,000 - $130,000
Skills:
GIS DEVELOPMENTARCGIS ENTERPRISEARCGIS ONLINEGEOSERVERMAPSERVEROPENLAYERSLEAFLETESRI-LEAFLETWMSWFSGEOJSONRESTSQL SERVERORACLEARCMAPARCGIS PRONETWCFWEBAPIJAVASCRIPT APIMS SQLT-SQLASP.NETDOCKERKUBERNETESANDROIDIOSAZUREAWSGOOGLE CLOUDGITLAB CIJENKINSJIRACONFLUENCE
Share this job:

Job Description

Posted on: January 25, 2026

Lensa is a career site that helps job seekers find great jobs in the US. We are not a staffing firm or agency. Lensa does not hire directly for these jobs, but promotes jobs on LinkedIn on behalf of its direct clients, recruitment ad agencies, and marketing partners. Lensa partners with DirectEmployers to promote this job for Insight Global. Clicking "Apply Now" or "Read more" on Lensa redirects you to the job board/employer site. Any information collected there is subject to their terms and privacy notice. Job Description We are seeking an experienced GIS Developer with expertise in spatial data modeling, geospatial analysis, and the implementation of GIS solutions. The ideal candidate will design, develop, and optimize GIS web services and applications, leveraging technologies such as JavaScript, Web API, C#, and industry-standard GIS platforms. Responsibilities include integrating advanced GIS functionalities, configuring and maintaining enterprise GIS environments, and contributing to research and development initiatives within the geospatial domain. Responsibilities

  •  Deliver GIS solutions efficiently and effectively.
  •  Set up and configure ArcGIS Enterprise environments.
  •  Tune GeoServer for optimal performance.
  •  Implement and manage containerized GIS applications.
  •  Collaborate with technical leads and project managers to meet business and technical requirements.
  •  Work flexibly within global teams across multiple time zones.
  •  Manage multiple projects or roles as needed.
  •  Demonstrate initiative and the ability to work independently.
  •  Contribute to R&D efforts.
  •  Exhibit strong English communication skills, both verbal and written

We are a company committed to creating diverse and inclusive environments where people can bring their full, authentic selves to work every day. We are an equal opportunity/affirmative action employer that believes everyone matters. Qualified candidates will receive consideration for employment regardless of their race, color, ethnicity, religion, sex (including pregnancy), sexual orientation, gender identity and expression, marital status, national origin, ancestry, genetic factors, age, disability, protected veteran status, military or uniformed service member status, or any other status or characteristic protected by applicable laws, regulations, and ordinances. If you need assistance and/or a reasonable accommodation due to a disability during the application or recruiting process, please send a request to HR@insightglobal.com.To learn more about how we collect, keep, and process your private information, please review Insight Global's Workforce Privacy Policy: https://insightglobal.com/workforce-privacy-policy/. Qualifications Skills and Requirements

  •  Bachelor’s degree in Computer Science, Information Technology, GIS, Geoinformatics, or equivalent experience.
  •  4–5 years of GIS development experience.

Technical Requirements

  •  Proficiency with ESRI platforms: ArcGIS Enterprise and ArcGIS Online, including setup and configuration.
  •  Strong knowledge of GIS principles: projections, geometric operations, geospatial analysis, and database design.
  •  Experience with open-source GIS tools (GeoServer, MapServer, OpenLayers, Leaflet, esri-leaflet), including GeoServer performance tuning.
  •  Familiarity with WMS (Web Map Service), WFS (Web Feature Service), and GeoJSON standards.
  •  Competency in REST standards.
  •  Skilled in SQL Server and Oracle, including schema design and advanced SQL.
  •  Experience with ArcMap, ArcGIS Pro, and publishing geospatial services.
  •  2–4 years developing custom web mapping applications (.NET 4 WCF, WebAPI, JavaScript API, MS SQL/T-SQL, ASP.NET).
  •  Experience with containerization technologies (e.g., Docker, Kubernetes).
  •  Exposure to mobile GIS development (Android, iOS) is a plus.
  •  Familiarity with cloud platforms (Azure, AWS, Google).
  •  Experience with CI/CD tools (GitLab CI, Jenkins) and agile collaboration tools (JIRA, Confluence).

If you have questions about this posting, please contact support@lensa.com

Originally posted on LinkedIn

Apply now

Please let the company know that you found this position on our job board. This is a great way to support us, so we can keep posting cool jobs every day!

DesignRemoteJobs.com logo

DesignRemoteJobs.com

Get DesignRemoteJobs.com on your phone!